PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000184538
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 279aa    MW: 32122.4 Da    PI: 9.0791
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000184538genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.64.3e-161464148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT...TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg...kgRtlkqcksrwqkyl 48
                     +g+WT+ Ed++l d++k +G g W++I+++     ++R++k+c++rw++yl
    MDP0000184538 14 KGAWTALEDQILTDYIKTHGEGKWRRIPKEADsasLRRCGKSCRLRWLNYL 64
                     79***********************************************97 PP

2Myb_DNA-binding56.75.5e-1870115148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ T+eE++l+++++k+lG++ W++Ia +++ gRt++++k++w++yl
    MDP0000184538  70 RGNITQEEEDLIIRLHKLLGNR-WSLIAGRIP-GRTDNEIKNYWNTYL 115
                      7999******************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.409964IPR017930Myb domain
SuperFamilySSF466891.65E-2912111IPR009057Homeodomain-like
SMARTSM007175.6E-131366IPR001005SANT/Myb domain
PfamPF002496.8E-141464IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-231571IPR009057Homeodomain-like
CDDcd001678.22E-91664No hitNo description
PROSITE profilePS5129427.33965119IPR017930Myb domain
SMARTSM007172.9E-1769117IPR001005SANT/Myb domain
PfamPF002492.4E-1670115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-2572119IPR009057Homeodomain-like
CDDcd001678.47E-1274115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MGRSPCCSKE GLNKGAWTAL EDQILTDYIK THGEGKWRRI PKEADSASLR RCGKSCRLRW  60
LNYLRPDIKR GNITQEEEDL IIRLHKLLGN RWSLIAGRIP GRTDNEIKNY WNTYLRKKVN  120
GAETPRLLGN KVDENNKKKR KRDNSEKTNP SVNKTKPRAM VKSDSFAVIR TKASKCNKVL  180
VMPDQLLDHQ INHGLLEDTT TTISEYSMLD FDVGELLVSE NNDIPDDSDF WKICQQLEDN  240
TNNGGSKNRC PSSTSLAPLL FSDEMLKDWM RDDFFNRQC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-281211925128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB8978651e-101AB897865.1 Prunus persica Peace mRNA for R2R3 Myb transcription factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008393595.10.0PREDICTED: transcription repressor MYB5-like
TrEMBLM5XPD91e-104M5XPD9_PRUPE; R2R3 Myb transcription factor
STRINGVIT_04s0008g01820.t013e-94(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.12e-61myb domain protein 3